Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650940.1 | internal | 276 | 3-830(+) |
Amino Acid sequence : | |||
TLLIHEGVKAEEEFEKTGKVPDPASTDNAEFQIVLGIIRDGLKVDPKRYHKMKERLVGVSEETTTGVKRLYQMQESGTLLFPAINVNDSVTKTKFDNLYGCRHSLPDGLMRATDIMIAGK VGVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGIPVQTLEDVVAEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPET NSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIA | |||
Physicochemical properties | |||
Number of amino acids: | 276 | ||
Molecular weight: | 11,075.786 | ||
Theoretical pI: | 8.801 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 64.909 | ||
aromaticity | 0.068 | ||
GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.330 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650940.1 | complete | 110 | 647-315(-) |
Amino Acid sequence : | |||
MHVDFIVKVTNVADNCIVLHLPHVINHDDVLVSCGGYKDVCLCDNIFKSLNWDSFHQCLEGTDGVNLSYDYTSTSLFECSCTALSNISVSTDNANLASNHNVSGPHESIR* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 11,075.786 | ||
Theoretical pI: | 8.801 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 64.909 | ||
aromaticity | 0.068 | ||
GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.330 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650940.1 | complete | 103 | 460-149(-) |
Amino Acid sequence : | |||
MGSISVTITRAPACLSAAAQPFPTSPYPQTTPTLPAIIMSVALMSPSGREWRQPYKLSNLVLVTESLTLIAGNNNVPLSCIWYNRLTPVVVSSETPTNLSFIL* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,075.786 | ||
Theoretical pI: | 8.801 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 64.909 | ||
aromaticity | 0.068 | ||
GRAVY | 0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.330 | ||
sheet | 0.252 |