Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650942.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
DNQQIHHQLEKELRDIKDQEQRMKPKRIKVISDLLISVSKAERQEARMKIRQDSLRLGNVGVIRAGTVISETWEDGQSLKDLNAHLRSLLETKEAIERHRKSLKKRQSDKGDGVDAEAGI SEEDFLIQDEICKSRLASIKREEEVLLRERDRYELEKGRLIREMKRVRDEDGSRFNNFQILNHRYALLNLLGKGGFSEVYKAYDLVEYRYVACKLHGLNAQWSEEKKQSYIRHAIREYNI HKSLVHHHIVRLWDI | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 30,145.964 | ||
Theoretical pI: | 9.148 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
Instability index: | 48.635 | ||
aromaticity | 0.059 | ||
GRAVY | -0.850 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.157 | ||
sheet | 0.278 |