Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650953.1 | 3prime_partial | 262 | 94-879(+) |
Amino Acid sequence : | |||
METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYQNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVI GGPHGDAGLTGRKIIIDTYGGW | |||
Physicochemical properties | |||
Number of amino acids: | 262 | ||
Molecular weight: | 12,790.441 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 62.637 | ||
aromaticity | 0.054 | ||
GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.214 | ||
sheet | 0.375 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650953.1 | 5prime_partial | 187 | 879-316(-) |
Amino Acid sequence : | |||
PATVGVNDDLATSKTSITMRTTNDKSARWVKVKDGLLIKVLLWDDRLDDVFLEVSCNFIIGHSFIMLSRDEYSVDTNGDHGSIFILVLNSDLGLAIGSQPCTGAILANLGKAGTQLGGKD MAERHQLRGLISGIAKHVSLVTSTNLLRALGKVAMDTLGNIRALLLNVDKNLAVVSIKTNIIGNKSN* | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 12,790.441 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 62.637 | ||
aromaticity | 0.054 | ||
GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.214 | ||
sheet | 0.375 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650953.1 | complete | 112 | 167-505(+) |
Amino Acid sequence : | |||
MQSLMPASNRTLTARLPARPAPRPTWSWFLVRSQPRPMLTMRRLFETPAVQLDLFPMMLVLMLTTARFLSTLSNKARILPRVSMATLPSALRRLVLVTRDTCLAMPLMRPLS* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,790.441 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 62.637 | ||
aromaticity | 0.054 | ||
GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.214 | ||
sheet | 0.375 |