Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650956.1 | internal | 277 | 1-831(+) |
Amino Acid sequence : | |||
GKTVLIMELINNVAKAHGGFSVFAGVGERTREGNDLYREMIESGVIKLGDKQSESKCALVYGQMNEPPGARARVGLTGLTVAEHFRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSA VGYQPTLATDLGGLQERITTTRKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRQISELGIYPAVDPLDSTSSMLSPYTLGEEHYNTARGVQKVLQNYKNLQDIIAILGMDELSE DDKLTVARARKIQRFLSQPFHVAEVFTGAPGKYVELK | |||
Physicochemical properties | |||
Number of amino acids: | 277 | ||
Molecular weight: | 30,117.781 | ||
Theoretical pI: | 5.329 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13410 | ||
Instability index: | 33.181 | ||
aromaticity | 0.069 | ||
GRAVY | -0.157 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.224 | ||
sheet | 0.274 |