Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650957.1 | 3prime_partial | 219 | 133-789(+) |
Amino Acid sequence : | |||
MSRKMLIDGEVSNAQEEAEKYDYDLFVIGAGSGGVRASRTAAGFGAKVAICELPFHPISSEVVGGVGGTCVIRGCVPKKILVYGASFSGEFEDARNYGWELNEKIGLNWKKLLENKTQEI VRLNGIYKRLLSNAGVKMFEGEGKVIGPNEVELTQLDGTRMSFSAKHILIATGSRAHRPAIPGMELAITSDEALSLEELPKRAVVLGGGYIAVEFASIW | |||
Physicochemical properties | |||
Number of amino acids: | 219 | ||
Molecular weight: | 11,287.587 | ||
Theoretical pI: | 9.421 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 26.823 | ||
aromaticity | 0.050 | ||
GRAVY | -0.524 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.230 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650957.1 | complete | 102 | 194-502(+) |
Amino Acid sequence : | |||
MIMICSLLVPAVAVFVLPELQLDLELRLLFASFLFIQLAQKLLGELVEHVSFVAVYQKRFWYMEHLFQVNLRMLEIMAGSSMKKLVLTGKSFWRIRHKKLLD* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,287.587 | ||
Theoretical pI: | 9.421 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 26.823 | ||
aromaticity | 0.050 | ||
GRAVY | -0.524 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.230 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650957.1 | 3prime_partial | 100 | 300-1(-) |
Amino Acid sequence : | |||
MKRKLANSNLSSKSSCSSGSTNTATAGTNNEQIIIILLRLFLSVADLTVDKHLSRHDYSTRDSSLIKVAGEQMIRVFFAFNGQLLRAARERERERERDDE | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,287.587 | ||
Theoretical pI: | 9.421 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 26.823 | ||
aromaticity | 0.050 | ||
GRAVY | -0.524 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.230 | ||
sheet | 0.280 |