Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650959.1 | 3prime_partial | 216 | 89-736(+) |
Amino Acid sequence : | |||
MSRKMLIDGEVSNAQEEAEKYDYDLFVIGAGSGGVRASRTAAGFGAKVAICELPFHPISSEVVGGVGGTCVIRGCVPKKILVYGASFSGEFEDARNYGWELNEKIGLNWKKLLENKTQEI VRLNGIYKRLLSNAGVKMFEGEGKVIGPNEVELTQLDGTRMSFSAKHILIATGSRAHRPAIPGMELAITSDEALSLEELPKRAVVLGGGYIAVEFA | |||
Physicochemical properties | |||
Number of amino acids: | 216 | ||
Molecular weight: | 11,982.478 | ||
Theoretical pI: | 9.515 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 33.085 | ||
aromaticity | 0.118 | ||
GRAVY | 0.674 | ||
Secondary Structure Fraction | |||
Helix | 0.471 | ||
turn | 0.118 | ||
sheet | 0.382 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650959.1 | complete | 102 | 150-458(+) |
Amino Acid sequence : | |||
MIMICSLLVPAVAVFVLPELQLDLELRLLFASFLFIQLAQKLLGELVEHVSFVAVYQKRFWYMEHLFQVNLRMLEIMAGSSMKKLVLTGKSFWRIRHKKLLD* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,982.478 | ||
Theoretical pI: | 9.515 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 33.085 | ||
aromaticity | 0.118 | ||
GRAVY | 0.674 | ||
Secondary Structure Fraction | |||
Helix | 0.471 | ||
turn | 0.118 | ||
sheet | 0.382 |