Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650982.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
ARATAAPLNQAYTADEFEFYLSDSESKILITPKEGNESAQSAAAKLNIPHVTASLPDAESEVSLCSTHPEFNSKPTQVELIERVFNQPSDVALFLHTSGTTSRPKGVPLTQFNLASSVQN IKSVYKLTESDSTVIVLPLFHVHGLLAGLLSSLGAGAAVTLPSAGRFSASTFWSDMIKYNANWYTAVPTIHQIILDRHISKPEPVYPKLRFIRSCSASLAPAVLARLEEAFGAPVLEAYA MTEASHLMASNPLPENGSHKP | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 28,115.523 | ||
Theoretical pI: | 5.987 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 42.892 | ||
aromaticity | 0.077 | ||
GRAVY | -0.044 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.276 | ||
sheet | 0.307 |