Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG650993.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
WVLIVLPLISLVGVALAQDLTSLISEATFNEMLKHRGEGNCRGGFYTYNAFITAARSFSGFATTGSTDDRKREIAAFFGQTSHETTGGWPAAPDGPFAWGYCFVEEQGNPGDLCQPSPQW PCAPGKKYYGRGPIQISWNFNYGQAGRAIGVDLINNPELVARDPVISFKTALWFWMTPQSPKPSCHDVILGRWRPSAADQAAGRVPGYGVITNIINGGIECGKGQNPQVENRIGFYRRYC SMLGVNPGGNL | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 27,327.597 | ||
Theoretical pI: | 8.192 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 57410 57785 | ||
Instability index: | 41.478 | ||
aromaticity | 0.120 | ||
GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.315 | ||
sheet | 0.195 |