Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG651005.1 | internal | 266 | 1-798(+) |
Amino Acid sequence : | |||
EEDMASSMNIERIEEGRIREESPRHHLNTMKKSFKTLVSKWWLLILNCVLFSIGTIGGPLLLRLYFLHGGSRRWIPAWSQSAGFPMLIFPIMFLYSRSPPGTKFLASPKFLLSGVAIGVL TGLDNFMYSYGLSFLPVSTSSLLLSTQLVFTAFFALIIVRHKFTPYSINAVVLMTLGSVLLGISKNADRPAGVTSAQYLLGFLITIGAACLLGFMLPCTEIAYTKAGKSMTYSSVLQFQL AASFSSTVFCTIGMLINKDFSAIASE | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 29,245.192 | ||
Theoretical pI: | 9.435 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34170 | ||
Instability index: | 51.507 | ||
aromaticity | 0.120 | ||
GRAVY | 0.534 | ||
Secondary Structure Fraction | |||
Helix | 0.387 | ||
turn | 0.263 | ||
sheet | 0.286 |