Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG651006.1 | internal | 284 | 2-853(+) |
Amino Acid sequence : | |||
KTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNE VSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLF DALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTY | |||
Physicochemical properties | |||
Number of amino acids: | 284 | ||
Molecular weight: | 31,028.956 | ||
Theoretical pI: | 8.607 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33350 33350 | ||
Instability index: | 46.925 | ||
aromaticity | 0.095 | ||
GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.303 | ||
sheet | 0.215 |