Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036233.1 | 5prime_partial | 152 | 2-460(+) |
Amino Acid sequence : | |||
KPKRANWARRRMLPAAMAAAGILLRGAPPTGTRVDPHVSFAGQGETHALRSVSGGPKGVRGLTLIFAIQRCNPAPFYPFEEIAAALDPQYRGADRNIISRLANSANTTFITIYSGQNSSK LPTIIRGNNRNRVANECLLKKQGLEFIDQTRT* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,569.821 | ||
Theoretical pI: | 11.078 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 46.220 | ||
aromaticity | 0.066 | ||
GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.276 | ||
sheet | 0.250 |