Acc_NO	ORF type	length	start-end position (strand +/-)
>JK036237.1	internal	114	343-2(-)
Amino Acid sequence :
LMTKDDLNLRQRRWLELLKDYQLSIEYHLGKGNIIADALSLKGEVTVSYLRQQYVPLLLEMASLRVSLELDSPPSVMARLSIRPLLLDMISEAQLLDEHLIRHTQRFLAGVRRG
Physicochemical properties
Number of amino acids:		114
Molecular weight:		13,167.280
Theoretical pI:		8.291
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11460
Instability index:		52.580
aromaticity		0.053
GRAVY		-0.062
Secondary Structure Fraction
Helix		0.377
turn		0.175
sheet		0.368