Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036238.1 | 5prime_partial | 201 | 1-606(+) |
Amino Acid sequence : | |||
LSQKLGEIARALARAQIDHKMFKKFTFEDVSAQNQVKASVQRRIRQSIADEYPGLEPLLDDLLPKKSPLLVAKCQNHLNLVVVNGVPLFFNVRDGPYMPTLRLLHQYPDIMKKLQVDRGA IKFVLSGANIMCPGLTSPGGALDEEVLEESPVAIMAEGKQHALAIGFTKMSAKDIRSINKGIGVDNMHYLNDGLWKMERLE* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 22,404.903 | ||
Theoretical pI: | 8.823 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 54.781 | ||
aromaticity | 0.060 | ||
GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.219 | ||
sheet | 0.299 |