Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036241.1 | 3prime_partial | 166 | 500-3(-) |
Amino Acid sequence : | |||
MARTMLNESSLPKYLWAEAVNTVCHVLNRCMVRPILKKTPFELYFGRKPSIFYFKPFGCKCFILNTLDKLSKFDSKVDEGIFVGYSSRSKAYRIFNKRVLTIIELVHVTFDESNKSSQVL KDRDDDEDLVNKLKAMELNKERLDIRESSGTKDLIDENNRELPSPQ | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 19,321.095 | ||
Theoretical pI: | 8.831 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 47.495 | ||
aromaticity | 0.096 | ||
GRAVY | -0.453 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.217 | ||
sheet | 0.235 |