Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036242.1 | complete | 124 | 546-172(-) |
Amino Acid sequence : | |||
MPDAWRHFTHPALILWFTSSSISPYLCNIDPKYRNASFLGITCSSRLTSPSSVMTPLKSHIRYSVLDLLSLKPFDSKVCLHNANFLSTPTLLSSISTTSSAKSIHQGISPCISLVTSFIT RAKI* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,673.736 | ||
Theoretical pI: | 9.639 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 48.629 | ||
aromaticity | 0.089 | ||
GRAVY | 0.190 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.315 | ||
sheet | 0.185 |