Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036268.1 | complete | 175 | 111-638(+) |
Amino Acid sequence : | |||
MLELAPARQHEDLPAYRVYEIIGSDEEIVDDRIVQVSTENLLLACSYRLFEKVGIFCRHILRVMDYMATTGRIQFRKIPHHYIMNRWTKYAKAGILITESEHSSKPIEYDLRYQYLCGMM VKLANNVCMNDKAYDIVDSQIRELCSRIQELLSDTRTSCDARRNSNTSGKYQLLV* | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 20,450.353 | ||
Theoretical pI: | 6.947 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22265 | ||
Instability index: | 49.369 | ||
aromaticity | 0.086 | ||
GRAVY | -0.312 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.166 | ||
sheet | 0.263 |