Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036269.1 | complete | 122 | 93-461(+) |
Amino Acid sequence : | |||
MRFLGQNPTEAELRDMIDEVDADRNGTIDFAEFLNLMARKMKDTDSEEELREAFKVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADTDGDGQVNYEEFVRMMLAKWDVSVCF PQ* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 14,164.644 | ||
Theoretical pI: | 4.249 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 25.978 | ||
aromaticity | 0.082 | ||
GRAVY | -0.643 | ||
Secondary Structure Fraction | |||
Helix | 0.254 | ||
turn | 0.139 | ||
sheet | 0.352 |