Acc_NO	ORF type	length	start-end position (strand +/-)
>JK036270.1	5prime_partial	112	2-340(+)
Amino Acid sequence :
TGAAFMDKELAFGRYWGEKAAAGRDLVDKFFNCEDVLLNFLYANASISTKAVEYVKPSWAIDTSKFSGVAISKNTQAHYHVRSDCIAEFTKLYGNLAGNIWRFSSRGDGWDV*
Physicochemical properties
Number of amino acids:		112
Molecular weight:		12,499.884
Theoretical pI:		6.640
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29450 29575
Instability index:		14.112
aromaticity		0.152
GRAVY		-0.206
Secondary Structure Fraction
Helix		0.321
turn		0.223
sheet		0.241