Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036270.1 | 5prime_partial | 112 | 2-340(+) |
Amino Acid sequence : | |||
TGAAFMDKELAFGRYWGEKAAAGRDLVDKFFNCEDVLLNFLYANASISTKAVEYVKPSWAIDTSKFSGVAISKNTQAHYHVRSDCIAEFTKLYGNLAGNIWRFSSRGDGWDV* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,499.884 | ||
Theoretical pI: | 6.640 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
Instability index: | 14.112 | ||
aromaticity | 0.152 | ||
GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.223 | ||
sheet | 0.241 |