Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036272.1 | complete | 143 | 66-497(+) |
Amino Acid sequence : | |||
MSMEVTLSVKQVDILWSDDTSVWTYGSTGSTEVIELLKGSLVVLSKKYEITKSGKYKVKINLMVKTGVANSFDFSLFVKPSPAYLTPATQKHLNPSTSAGFDYIESEEFFATEHTSIFFY LVSHNPELKTGLIIKDVIISGPK* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 12,868.719 | ||
Theoretical pI: | 6.941 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40700 | ||
Instability index: | 48.927 | ||
aromaticity | 0.133 | ||
GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.248 | ||
sheet | 0.221 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036272.1 | complete | 113 | 553-894(+) |
Amino Acid sequence : | |||
MTCYPIYLLCVVVFVSHAVAWNKFKEFTSLSAWNVSLKLLSVGPHYVDSTWGMYRMHDKNDVCDQLFCTWPGRPLEITSQLTASGRSTYGEDLPAHWMHSLSSPILSPKIAWT* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,868.719 | ||
Theoretical pI: | 6.941 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40700 | ||
Instability index: | 48.927 | ||
aromaticity | 0.133 | ||
GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.248 | ||
sheet | 0.221 |