Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036295.1 | internal | 144 | 1-432(+) |
Amino Acid sequence : | |||
PPGQVDLIQRHDLFDDSMKAAGLTGVETGTKLYISNLDFGVSNEDIKELFSEIGVLRRSSVHYDRNGRPNGSAEVVFNRRSDALAALKRYNNVQLDGKPMKIEVIGTNLGLPVTPRINVV GGGGRGTRTVVMTPEFSQGVARGG | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,524.370 | ||
Theoretical pI: | 9.154 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 40.104 | ||
aromaticity | 0.056 | ||
GRAVY | -0.336 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.306 | ||
sheet | 0.201 |