Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036299.1 | complete | 130 | 27-419(+) |
Amino Acid sequence : | |||
MAGRAQIPNKSSALIAMIADEDTVTGFLMAGVGNVDLRRKTNYLIVDSKTTVKQIEDAFKEFTNKEDIAVVLISQYIANMIRFLVDSYNKPVPAILEIPSKDHPYDPSHDSVLSRVRYLF STESVASGRR* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 14,493.422 | ||
Theoretical pI: | 6.729 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 46.630 | ||
aromaticity | 0.077 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.223 | ||
sheet | 0.231 |