Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036304.1 | internal | 128 | 3-386(+) |
Amino Acid sequence : | |||
KTVNLLKGEQHTPEFEKLNPLKYVPVLVDDDVTIADSFAILLYLEDKYPEHPLLPRDDLQKKALNIQAASIVASGIQPLQNLGALNFIEEKLGSDEKLVWVQQHIGKGFAALEKLLAGYG GKYAIGDE | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,154.060 | ||
Theoretical pI: | 5.026 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 30.140 | ||
aromaticity | 0.078 | ||
GRAVY | -0.162 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.203 | ||
sheet | 0.320 |