Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036308.1 | complete | 143 | 29-460(+) |
Amino Acid sequence : | |||
MSMEVTLSVKQVDILWSDDTSVWTYGSAGSTEVIELLKGSLVVLSKKYEITKSGKYKVKINLMVKTGVANSFDFSLFVKPSPAYLTPATQKHLNPSTSAGFDYIESEEFFATEHTSIFFY LVSHNPELKTGLIIRDVIISGPK* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,877.050 | ||
Theoretical pI: | 6.283 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 34.166 | ||
aromaticity | 0.112 | ||
GRAVY | 0.031 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.252 | ||
sheet | 0.217 |