Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036333.1 | complete | 142 | 70-498(+) |
Amino Acid sequence : | |||
MGKTRGMGAGRKLKTHRRNQRWADKAYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFK VVKVSGVSLLALFKEKKEKPRS* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,690.206 | ||
Theoretical pI: | 10.372 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 19.112 | ||
aromaticity | 0.063 | ||
GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.246 | ||
sheet | 0.225 |