Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036352.1 | complete | 143 | 52-483(+) |
Amino Acid sequence : | |||
MSMEVTLSVKQVDILWSDDTSVWTYGSAGSTEVIELLKGSLVVLSKKYEITKSGKYKVKINLMVKTGVANSFDFSLFVKPSPAYLTPSTQKHLNPSTSAGFDYIESEEFFATEHTSIFFY LVSHNPELKTGLIITDVIISGPK* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,837.968 | ||
Theoretical pI: | 5.885 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 34.166 | ||
aromaticity | 0.112 | ||
GRAVY | 0.039 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.259 | ||
sheet | 0.210 |