Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036378.1 | internal | 219 | 658-2(-) |
Amino Acid sequence : | |||
IVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVAGVNEKSYKPDINIVSNASCTTNCLAPLAKVVNDRFGIIEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAA KAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKPASYEQIKAAIKEESEGNLKGILGYTEEDLVSTDFIGDTRSGIFDAKAGIALNDYFVKLVAW | |||
Physicochemical properties | |||
Number of amino acids: | 219 | ||
Molecular weight: | 23,074.191 | ||
Theoretical pI: | 8.454 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 23.094 | ||
aromaticity | 0.064 | ||
GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.242 | ||
sheet | 0.242 |