Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036379.1 | 5prime_partial | 166 | 1-501(+) |
Amino Acid sequence : | |||
TVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDDLVEKFASGVSMVAALSLALSYPTLAAAPHMFINAYKNVLAVAVATEYTFPQAEKVKEYLK DPSKFAVTAAPVAAAETAAPAAAKEEEKKEEPAEESDDDMGFSLFD* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 15,589.676 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 89.853 | ||
aromaticity | 0.069 | ||
GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.244 | ||
sheet | 0.321 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036379.1 | complete | 131 | 134-529(+) |
Amino Acid sequence : | |||
MDPSSVLRFWTLQRMTLLRSLPAVFLWSLHCPWPSHTPRLLLHLTCSSMPTKMSLLLLWPLNTLSHRQRRSRNISRIPANLLSQLHLLLLRRLQPLLRPRRKRRKRNLLRSLMMTWASAY SIRSLCFGMIN* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 15,589.676 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 89.853 | ||
aromaticity | 0.069 | ||
GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.244 | ||
sheet | 0.321 |