Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036392.1 | complete | 125 | 33-410(+) |
Amino Acid sequence : | |||
MLPAAMAAAGIRLAWSRPRYIGVKVKVSFTGQGETQSMKQLSGGQKTVVALTLIFAIQRCDPAPFYLFDEIDAALDPQYRTAVGNMIRRLADSANTQFITTTFRPELVKVADKIYGVTPG TGSAK* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,555.586 | ||
Theoretical pI: | 9.774 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 29.212 | ||
aromaticity | 0.088 | ||
GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.200 | ||
sheet | 0.256 |