Acc_NO	ORF type	length	start-end position (strand +/-)
>JK036392.1	complete	125	33-410(+)
Amino Acid sequence :
MLPAAMAAAGIRLAWSRPRYIGVKVKVSFTGQGETQSMKQLSGGQKTVVALTLIFAIQRCDPAPFYLFDEIDAALDPQYRTAVGNMIRRLADSANTQFITTTFRPELVKVADKIYGVTPG TGSAK*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		13,555.586
Theoretical pI:		9.774
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11460
Instability index:		29.212
aromaticity		0.088
GRAVY		0.029
Secondary Structure Fraction
Helix		0.296
turn		0.200
sheet		0.256