Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036397.1 | complete | 153 | 29-490(+) |
Amino Acid sequence : | |||
MSMEQMQVTLSVKQVDILWSDDTSVWTYGSAGSTEVIELLKGSLVVLSKKYEITKSGKYKVKINLMVKTGVANSFDFSLFVKPSPGYLTPATQKHLNPSTSAGFDYIESEEFFATEHTSI FFYLVSHNPQLKTGLIIKDVIISGPQVKITLPN* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,987.377 | ||
Theoretical pI: | 6.829 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 31.895 | ||
aromaticity | 0.105 | ||
GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
Helix | 0.359 | ||
turn | 0.255 | ||
sheet | 0.203 |