Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036400.1 | internal | 204 | 2-613(+) |
Amino Acid sequence : | |||
QTHPNITIIGEEVAAKKQTLKSVTDYITDVICKRAELGYNYGVIVIPEGLIDFIPEVQQLISELNEILAHDVVDEGGLWKKKLRNQSQVLFDFLPQAIQEQLMLERDPHGNVQVAKIETE KMLIQMVETELEKRKSEGKYKGSFKGQSHFFGYEGRCGLPTNFDSTYCYALGYAAGALLHAGKTGLISSVSNLSAPVAEWDCWR | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,850.840 | ||
Theoretical pI: | 5.425 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28670 | ||
Instability index: | 37.092 | ||
aromaticity | 0.088 | ||
GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.206 | ||
sheet | 0.265 |