Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036404.1 | internal | 128 | 1-384(+) |
Amino Acid sequence : | |||
TNLILINLTKEFLSSKFSMKDMGETDVILGIRIKREDKGYSISQAHYIEKILKKFHVSECCPASTPMDPNIKYTLNEGECISQLEYSKVIGCLMYAMTSTRPDIAFAVGKLSRYPSNPSA PHWPGIMR | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,450.698 | ||
Theoretical pI: | 8.666 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
Instability index: | 43.039 | ||
aromaticity | 0.086 | ||
GRAVY | -0.218 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.258 | ||
sheet | 0.234 |