Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036417.1 | 5prime_partial | 125 | 3-380(+) |
Amino Acid sequence : | |||
WKTVKKPEQQETKNENQQESMHQVPVMEMQRSKSMPLSDTRVNLSVTGSGSKEEDIEKMKKLSCWWTRSNWAFLNEPPVIATEGSHKYAARSTLRSWEAHRAPGCLRPAVNRIAVVSMSE SEYEI* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 14,364.112 | ||
Theoretical pI: | 8.623 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
Instability index: | 79.045 | ||
aromaticity | 0.064 | ||
GRAVY | -0.858 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.256 | ||
sheet | 0.272 |