Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036425.1 | 5prime_partial | 166 | 2-502(+) |
Amino Acid sequence : | |||
DRGEEPCYAGVPMSTIIERGYGVGDVISLLWFKRSLPRYCTQFIEICIMLCADHGPCVSGAHNTIVTARAGKDLVSSLVSGLLTIGPRFGGAIDDAARYFKDAHDRGLTPYEFVESMKKK GIRVPGIGHRIKSRDNRDKRVQLLQKYAAHSFPFCEVPSAPDHANH* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,331.846 | ||
Theoretical pI: | 8.770 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 31.890 | ||
aromaticity | 0.084 | ||
GRAVY | -0.231 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.241 | ||
sheet | 0.205 |