Acc_NO	ORF type	length	start-end position (strand +/-)
>JK036458.1	5prime_partial	269	1-810(+)
Amino Acid sequence :
TIGNNSITISKVLLVEGLRHSLLSISQLCDCGFEVKFKQNEVLVISNDDGQIKLVGKRVNNIYHVELDFDPTKKLCLSISNENDPWLWHRRLGHASMGILKKLVSKELVRGLPKINFEKD LICEACQRGKQTKTVFKSKDIVSTSKPLDLLHLDLFGPVQHTSLAGKRFVLVVVDDYSRYTWTYFLAHKNDTFESLVSLIKILETQRSSKVVCLRSDHGGEFENESFASFCDKKGITHQF SAPRTPQQNGGSLKGRTELSKKWHVPMPK*
Physicochemical properties
Number of amino acids:		269
Molecular weight:		30,466.825
Theoretical pI:		9.237
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27960 28335
Instability index:		29.672
aromaticity		0.078
GRAVY		-0.312
Secondary Structure Fraction
Helix		0.331
turn		0.234
sheet		0.201