Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036511.1 | complete | 104 | 1-315(+) |
Amino Acid sequence : | |||
MSIRVAGAMSDCMNNVGDSVVELKQSMETMGQLGGKDIGFQLNSIQTWVSAALTEDDTCMDGFSGNSMNGEVKTAVRSHVLNTAQLTSNALFFINSLAAVHSSP* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 10,989.273 | ||
Theoretical pI: | 4.595 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 37.113 | ||
aromaticity | 0.048 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.298 | ||
sheet | 0.269 |