Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036556.1 | 5prime_partial | 116 | 2-352(+) |
Amino Acid sequence : | |||
PGQVMQVIIETNRTTARIFPAVLDVENPEFKRKLDRMVDINEKLLAVGDSNDIPLVKNLKRVPLIAALVSEILAAYLMPPIESGSVDFAEFEPQIVYLGRDHANRIPAAAMAAGSM* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,727.697 | ||
Theoretical pI: | 5.088 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 35.649 | ||
aromaticity | 0.052 | ||
GRAVY | 0.134 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.216 | ||
sheet | 0.328 |