Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036572.1 | 5prime_partial | 120 | 3-365(+) |
Amino Acid sequence : | |||
KSKEKEMASEPSPQLYKHVILAKLKEGVDKEKHLALLMKFASLPFFIPGMKSFHWAEDESKIVKNKGYNYVFEITFESMEDISNYYDHPGHADFAKEVETVVEDYIVVNYKPMVFTVPGM * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,896.859 | ||
Theoretical pI: | 5.721 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 31.363 | ||
aromaticity | 0.133 | ||
GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.200 | ||
sheet | 0.275 |