Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036695.1 | 5prime_partial | 174 | 2-526(+) |
Amino Acid sequence : | |||
ELFVGRVAMIGFAASLLGEGITGKGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGKFVDEPTGAGEGCHPPGQCPDCTRDSKKEGPLFGFTKSNELFVGRLAQLGIAFSLI GEIITGKGALAQLNIDTGVPINELEPLILFNVVFFFFAALSPGTGKFITDEEEE* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 18,421.074 | ||
Theoretical pI: | 4.477 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 19.734 | ||
aromaticity | 0.098 | ||
GRAVY | 0.415 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.259 | ||
sheet | 0.316 |