Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036726.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
GLGPNYLMLPVNAPKCAHHNNHYDGAMNFMHRDEEVDYYPSRHAPLRHAQRHPIPSRPVTGRRDKCPIPKLNDFKQPGERYRSWAPDRQDRFIQRWVESLSHPKVSYELRSIWVSYLAKC DASLGQKVGNRLNVKPSM* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 16,100.147 | ||
Theoretical pI: | 9.748 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 54.949 | ||
aromaticity | 0.094 | ||
GRAVY | -0.935 | ||
Secondary Structure Fraction | |||
Helix | 0.254 | ||
turn | 0.283 | ||
sheet | 0.196 |