Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036786.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
KKAMASTSAVAMAVLPSPSTVVSRRTAFFNPMKVTAGATPGRIPAARRFEVRASSSNKEQVVAGLTAAAMAAAFLVPDIAEAAQPGISPSLKNFLFSIVSGGVVLVAIVGAVIGVANFDP VKRT* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 12,983.147 | ||
Theoretical pI: | 6.499 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
Instability index: | 51.626 | ||
aromaticity | 0.044 | ||
GRAVY | -1.068 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.289 | ||
sheet | 0.175 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK036786.1 | complete | 114 | 509-165(-) |
Amino Acid sequence : | |||
MIIDSTPQTDTTRLHCSINYQNNKINTWRYSKEKKTRGDSCKLSSSSLHRVEVGDSDDSPNDGHEHNSTGNDAEKEVLERRRYPRLSCLCDVWNQERRCHGCSCEAGNNLLLVG* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,983.147 | ||
Theoretical pI: | 6.499 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
Instability index: | 51.626 | ||
aromaticity | 0.044 | ||
GRAVY | -1.068 | ||
Secondary Structure Fraction | |||
Helix | 0.202 | ||
turn | 0.289 | ||
sheet | 0.175 |