Acc_NO	ORF type	length	start-end position (strand +/-)
>JK312910.1	internal	127	1-381(+)
Amino Acid sequence :
AMASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPL VPEIARM
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,784.749
Theoretical pI:		8.747
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35980 36230
Instability index:		61.853
aromaticity		0.087
GRAVY		-0.396
Secondary Structure Fraction
Helix		0.315
turn		0.197
sheet		0.228

Acc_NO	ORF type	length	start-end position (strand +/-)
>JK312910.1	internal	127	381-1(-)
Amino Acid sequence :
HACNLRNQRIIWVRVRQQRTDGEQDLGDGQSRAPLFLQNVKANASIAIDIWMEDLRPKCYLRWFEGIVWRKVDGNQENSSCIWTIWGTHYSCLPMEHVFSHRTCAARGGRILLQILQLLE DALRSHG
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,784.749
Theoretical pI:		8.747
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35980 36230
Instability index:		61.853
aromaticity		0.087
GRAVY		-0.396
Secondary Structure Fraction
Helix		0.315
turn		0.197
sheet		0.228