Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK312922.1 | internal | 106 | 1-318(+) |
Amino Acid sequence : | |||
YPLENYGSDIAGRSFHNGRFIQRMREKAASLPNVQLEQGTVTSLIEENGTIKGVTYKSKSGEELRAYAPLTIVCDGCLSNLRRALCSPRVDVPSCFVGLVLENCQL | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,665.208 | ||
Theoretical pI: | 7.804 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6210 | ||
Instability index: | 44.377 | ||
aromaticity | 0.066 | ||
GRAVY | -0.193 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.274 | ||
sheet | 0.255 |