Acc_NO	ORF type	length	start-end position (strand +/-)
>JK312922.1	internal	106	1-318(+)
Amino Acid sequence :
YPLENYGSDIAGRSFHNGRFIQRMREKAASLPNVQLEQGTVTSLIEENGTIKGVTYKSKSGEELRAYAPLTIVCDGCLSNLRRALCSPRVDVPSCFVGLVLENCQL
Physicochemical properties
Number of amino acids:		106
Molecular weight:		11,665.208
Theoretical pI:		7.804
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 6210
Instability index:		44.377
aromaticity		0.066
GRAVY		-0.193
Secondary Structure Fraction
Helix		0.302
turn		0.274
sheet		0.255