Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK341315.1 | 5prime_partial | 105 | 2-319(+) |
Amino Acid sequence : | |||
SCGHDGPFGATGVKRLRSIGMIERVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGNICGKRSS* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 10,937.709 | ||
Theoretical pI: | 8.767 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 46.049 | ||
aromaticity | 0.019 | ||
GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.295 | ||
sheet | 0.295 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK341315.1 | 5prime_partial | 105 | 2-319(+) |
Amino Acid sequence : | |||
SCGHDGPFGATGVKRLRSIGMIERVPGMKALDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGNICGKRSS* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 10,937.709 | ||
Theoretical pI: | 8.767 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 46.049 | ||
aromaticity | 0.019 | ||
GRAVY | 0.041 | ||
Secondary Structure Fraction | |||
Helix | 0.229 | ||
turn | 0.295 | ||
sheet | 0.295 |