Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK341317.1 | internal | 104 | 2-313(+) |
Amino Acid sequence : | |||
LVLNGKLEKEFSLSSTDLFHSPAGFVQLSLAYAGASPEVMAIPALKPVAADETGQESELSESLDKIEFPDPKIVNENQMMVSEYFGIPCSNMDSETSDSLDNSD | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,217.320 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 39.485 | ||
aromaticity | 0.067 | ||
GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.308 | ||
sheet | 0.327 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK341317.1 | internal | 104 | 2-313(+) |
Amino Acid sequence : | |||
LVLNGKLEKEFSLSSTDLFHSPAGFVQLSLAYAGASPEVMAIPALKPVAADETGQESELSESLDKIEFPDPKIVNENQMMVSEYFGIPCSNMDSETSDSLDNSD | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,217.320 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 39.485 | ||
aromaticity | 0.067 | ||
GRAVY | -0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.308 | ||
sheet | 0.327 |