Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK341351.1 | 5prime_partial | 118 | 1-357(+) |
Amino Acid sequence : | |||
LLRPEGPFGATGVKRLRSIGMIERVPGMKAFDMNTAEDAIVRLTREIVPGMIVTGMEVAEIDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNALDGTYVGNVHPELILAAADSAFFC* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,455.491 | ||
Theoretical pI: | 6.114 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 36.309 | ||
aromaticity | 0.051 | ||
GRAVY | 0.262 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.254 | ||
sheet | 0.339 |