Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK341361.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
RCLVLVVLMIVATLNFRDIQVSAQCGGGILNLVAQCSSFVGVKGPKIPPSAGCCSAVKSSDIPCVCSLVTPDIEKSISMEKVVYVARTCGLNIPPGMKCGSYTFSTRKADIRRQAEVGKL HALL* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 12,150.614 | ||
Theoretical pI: | 10.357 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 44.737 | ||
aromaticity | 0.084 | ||
GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.290 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK341361.1 | complete | 107 | 363-40(-) |
Amino Acid sequence : | |||
MQFPNLSLSSYISLPGGKSIASTFHPWWNIETTSSCYIHHLLHANTLLYIRCNKATNTRDVGRFHGRATTGRRGDFRTLNPHEARALSNKIKNTSSTLRRDLNIPEV* | |||
Physicochemical properties | |||
Number of amino acids: | 107 | ||
Molecular weight: | 12,150.614 | ||
Theoretical pI: | 10.357 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 44.737 | ||
aromaticity | 0.084 | ||
GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.290 | ||
sheet | 0.196 |