| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK341389.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
| HTTLRPNLEQSKVDFVKSLPNADTRLVLFEAEIYNPDTFEKAIQGCEYVFHVATAVQHTEGYQFKNIVEACVAAAKKIATFCVQSGTVKRLIYTSSVTCGSPLKEDGSGYKDFMDDICWT PLHHPLTLSTGYLKEYIESKMKSEKEIMTIGRNNNLEVVALALGMVAGDTNLPYSFIPISVMGCLCQIADNEFIYK | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 21,848.859 | ||
| Theoretical pI: | 5.540 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
| Instability index: | 26.822 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.204 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK341389.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
| HTTLRPNLEQSKVDFVKSLPNADTRLVLFEAEIYNPDTFEKAIQGCEYVFHVATAVQHTEGYQFKNIVEACVAAAKKIATFCVQSGTVKRLIYTSSVTCGSPLKEDGSGYKDFMDDICWT PLHHPLTLSTGYLKEYIESKMKSEKEIMTIGRNNNLEVVALALGMVAGDTNLPYSFIPISVMGCLCQIADNEFIYK | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 21,848.859 | ||
| Theoretical pI: | 5.540 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
| Instability index: | 26.822 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.204 | ||
| sheet | 0.250 | ||