Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK341389.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
HTTLRPNLEQSKVDFVKSLPNADTRLVLFEAEIYNPDTFEKAIQGCEYVFHVATAVQHTEGYQFKNIVEACVAAAKKIATFCVQSGTVKRLIYTSSVTCGSPLKEDGSGYKDFMDDICWT PLHHPLTLSTGYLKEYIESKMKSEKEIMTIGRNNNLEVVALALGMVAGDTNLPYSFIPISVMGCLCQIADNEFIYK | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,848.859 | ||
Theoretical pI: | 5.540 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
Instability index: | 26.822 | ||
aromaticity | 0.097 | ||
GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.204 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK341389.1 | internal | 196 | 2-589(+) |
Amino Acid sequence : | |||
HTTLRPNLEQSKVDFVKSLPNADTRLVLFEAEIYNPDTFEKAIQGCEYVFHVATAVQHTEGYQFKNIVEACVAAAKKIATFCVQSGTVKRLIYTSSVTCGSPLKEDGSGYKDFMDDICWT PLHHPLTLSTGYLKEYIESKMKSEKEIMTIGRNNNLEVVALALGMVAGDTNLPYSFIPISVMGCLCQIADNEFIYK | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,848.859 | ||
Theoretical pI: | 5.540 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19285 | ||
Instability index: | 26.822 | ||
aromaticity | 0.097 | ||
GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.204 | ||
sheet | 0.250 |