| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK341397.1 | internal | 117 | 352-2(-) |
Amino Acid sequence : | |||
| PFSSCFHCFCLAMAASVDPLVVGRVIGDVVDMFVPTVSMSVYYGPKHVTNGCDIKPSMAIGPPKINITGHSDELYTLVMTDPDAPSPSEPSMREWVHWIVVDIPGGTSPTKGKEILP | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,588.472 | ||
| Theoretical pI: | 5.086 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 38.549 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.308 | ||
| sheet | 0.171 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK341397.1 | internal | 117 | 352-2(-) |
Amino Acid sequence : | |||
| PFSSCFHCFCLAMAASVDPLVVGRVIGDVVDMFVPTVSMSVYYGPKHVTNGCDIKPSMAIGPPKINITGHSDELYTLVMTDPDAPSPSEPSMREWVHWIVVDIPGGTSPTKGKEILP | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,588.472 | ||
| Theoretical pI: | 5.086 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 38.549 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.308 | ||
| sheet | 0.171 | ||