Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK341397.1 | internal | 117 | 352-2(-) |
Amino Acid sequence : | |||
PFSSCFHCFCLAMAASVDPLVVGRVIGDVVDMFVPTVSMSVYYGPKHVTNGCDIKPSMAIGPPKINITGHSDELYTLVMTDPDAPSPSEPSMREWVHWIVVDIPGGTSPTKGKEILP | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,588.472 | ||
Theoretical pI: | 5.086 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 38.549 | ||
aromaticity | 0.077 | ||
GRAVY | 0.168 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.308 | ||
sheet | 0.171 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JK341397.1 | internal | 117 | 352-2(-) |
Amino Acid sequence : | |||
PFSSCFHCFCLAMAASVDPLVVGRVIGDVVDMFVPTVSMSVYYGPKHVTNGCDIKPSMAIGPPKINITGHSDELYTLVMTDPDAPSPSEPSMREWVHWIVVDIPGGTSPTKGKEILP | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,588.472 | ||
Theoretical pI: | 5.086 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 38.549 | ||
aromaticity | 0.077 | ||
GRAVY | 0.168 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.308 | ||
sheet | 0.171 |