| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK341403.1 | internal | 161 | 1-483(+) |
Amino Acid sequence : | |||
| TKFNRAVEGSRKCRKIFVDIIKQRKIDLFEKDRKEANDVLSNILLENHRDGIETKDVVLAKNLVSLLSAAFDNPSVTIVSIIKNLAENPEIYARVRSEQLEIAKGKAPGENLTMEDLKKM KFSMNVLRESLRMEAPASGTFRKALNDFTYEGYLIPKGWKG | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 18,300.982 | ||
| Theoretical pI: | 9.405 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 32.490 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.429 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.211 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK341403.1 | internal | 161 | 1-483(+) |
Amino Acid sequence : | |||
| TKFNRAVEGSRKCRKIFVDIIKQRKIDLFEKDRKEANDVLSNILLENHRDGIETKDVVLAKNLVSLLSAAFDNPSVTIVSIIKNLAENPEIYARVRSEQLEIAKGKAPGENLTMEDLKKM KFSMNVLRESLRMEAPASGTFRKALNDFTYEGYLIPKGWKG | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 18,300.982 | ||
| Theoretical pI: | 9.405 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 32.490 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.429 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.211 | ||
| sheet | 0.286 | ||