| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK479929.1 | internal | 107 | 1-321(+) |
Amino Acid sequence : | |||
| QQRGKLTVHAEECINSKTTTELILRCSDLEYKDLFARNDPFLVISKIVEGGMPIPVCETEVLKNELKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKIQ | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,104.852 | ||
| Theoretical pI: | 6.135 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 41.479 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.234 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JK479929.1 | internal | 107 | 1-321(+) |
Amino Acid sequence : | |||
| QQRGKLTVHAEECINSKTTTELILRCSDLEYKDLFARNDPFLVISKIVEGGMPIPVCETEVLKNELKPTWKSVFLNIQQVGSKDSPLIIECFNFNSNGKHDLIGKIQ | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,104.852 | ||
| Theoretical pI: | 6.135 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 41.479 | ||
| aromaticity | 0.065 | ||
| GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.234 | ||
| sheet | 0.215 | ||